SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 354848 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  354848
Domain Number 1 Region: 99-226
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 9.12e-53
Family XPF/Rad1/Mus81 nuclease 0.000000364
Further Details:      
 
Domain Number 2 Region: 223-293
Classification Level Classification E-value
Superfamily RuvA domain 2-like 3.2e-16
Family Hef domain-like 0.0000825
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 354848
Sequence length 298
Comment $ JCSG $ SQ12642 $ PDBT21474 $
Sequence
MDPGKDEESRPQPSGPPTRRKFVIPLEEEEVPCAGVKPLFRSSRNPTIPATSAHVAPQTY
AEYAITQPPGGAGATVPTGSEPAAGENPSQTLKTGAKSNSIIVSPRQRGNPVLKFVRNVP
WEFGEVIPDYVLGQSTCALFLSLRYHNLHPDYIHERLQSLGKNFALRVLLVQVDVKDPQQ
ALKELAKMCILADCTLVLAWSAEEAGRYLETYKAYEQKPADLLMEKLEQNFLSRATECLT
TVKSVNKTDSQTLLATFGSLEQLFTASREDLALCPGLGPQKARRLFEVLHEPFLKVPR
Download sequence
Identical sequences P07903
ENSMUSP00000003645 NP_031974.2.92730 10090.ENSMUSP00000003645 354848 ENSMUSP00000003645 ENSMUSP00000003645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]