SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 354898 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  354898
Domain Number 1 Region: 321-400
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000375
Family PCI domain (PINT motif) 0.06
Further Details:      
 
Domain Number 2 Region: 122-243
Classification Level Classification E-value
Superfamily TPR-like 0.0000635
Family Tetratricopeptide repeat (TPR) 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 354898
Sequence length 429
Comment $ JCSG $ SQ12688 $ PDBT21524 $
Sequence
MVDVEEKSQEVEYVDPTVNRVPNYEVSEKAFLLTQSKVSIEQRKEAAEFVLAKIKEEEMA
PYYKYLCEEYLVNNGQSDLEHDEKSDSLNEWIKFDQELYNELCKKNESKIKELNEKIQKL
EEDDEGELEQAQAWINLGEYYAQIGDKDNAEKTLGKSLSKAISTGAKIDVMLTIARLGFF
YNDQLYVKEKLEAVNSMIEKGGDWERRNRYKTYYGIHCLAVRNFKEAAKLLVDSLATFTS
IELTSYESIATYASVTGLFTLERTDLKSKVIDSPELLSLISTTAALQSISSLTISLYASD
YASYFPYLLETYANVLIPCKYLNRHADFFVREMRRKVYAQLLESYKTLSLKSMASAFGVS
VAFLDNDLGKFIPNKQLNCVIDRVNGIVETNRPDNKNAQYHLLVKQGDGLLTKLQKYGAA
VRLTGSDRV
Download sequence
Identical sequences A0A0L8VG61 A0A250WDV7 A6ZWY8 B3LK72 C7GXR9 N1NVL0 Q06103
YPR108W YPR108W tr|A6ZWY8|A6ZWY8_YEAS7 YPR108W YPR108W YPR108W YPR108W YPR108W 354898 YPR108W NP_015433.1.97178 3jck_D 3jco_R 3jcp_R 4cr2_R 4cr3_R 4cr4_R 5a5b_R 5mpb_R 5mpc_R 5mpd_R 5mpe_R 5wvi_R 5wvk_R YPR108W YPR108W YPR108W SCRT_02585 YPR108w___KOG0687 YPR108W 4932.YPR108W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]