SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 354982 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  354982
Domain Number 1 Region: 154-451,515-641
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.12e-128
Family Myotubularin-like phosphatases 0.000000308
Further Details:      
 
Domain Number 2 Region: 8-56,83-141
Classification Level Classification E-value
Superfamily PH domain-like 0.00000291
Family GRAM domain 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 354982
Sequence length 688
Comment $ JCSG $ SQ12771 $ PDBT21608 $
Sequence
MEYIKIAKVSNVVLHRRGTATQGTLHLTTHHLIFESPQLSTEFWFPYPLIYGVHKNPGST
LLSKLTSTNQIQLEGTDSQNYKLYQGKDLWSFVNIKVIGKDYAVFSLDFGGDLHLQARKV
YDSILNLTVLSNITQLYAFIYISNNLERKLPSPDSWDIYDPIKEFRRQGLDSKDETCPWR
LSTVNEHYEFCPTYPSKLFVPRSTSDILLKHASKFRSQKRIPVLTYHHKATDCNILRSSQ
PLPGLINQRSIQDEKLVWESFNSFCNKDIRRTKHVIVDARPRTNALAQMALGGGTENMDN
YNFFLADNNMGVDKSLKLPTVTRLFLGIDNIHIVSNTAAYMTEVICQGGDLNLPLEQNLI
RSQKFSNWLKLNTLILKSVDMLLKSIIFNHSNVLVHCSDGWDRTSQVVSLLEICLDPFYR
TFEGFMILVEKDWCSFGHRFLERSGHLNSDIRFHDNTMHSNFNDVDTNGDDLDIGVNTQD
DYAEDDEGGEDETNLINLSRISKKFNENFKLNKKSLKFVSPVFQQFLDCVYQLLTQNPDL
FEFNERFLRRLVYHLYSCQYGTFLSNSEKEKFQQNLPNKTKSVWDYFRSRRKQFINPNFI
QRKRSGMNEHDQNLEEEEKVEWISPDLKKVQWWWQLYGRKDSEMNDELRHKRDSVPISVD
KKSKEHSNSDGGKGLNLSIFGFDMFNRK
Download sequence
Identical sequences B3LQJ4 B5VLQ4 P47147
YJR110W YJR110W SCRT_03761 YJR110W YJR110W 354982 YJR110W 4932.YJR110W YJR110W NP_012644.1.97178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]