SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 357474 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  357474
Domain Number 1 Region: 33-117
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 0.000000279
Family Hjc-like 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 357474
Sequence length 140
Comment $ JCSG $ SQ87615 $ PDBT22973 $
Sequence
MVQVVYPNMADLEIGNVKEVYNKILASLNEYYGKMFENLVFEMLKLKIIDFGQKSVAKWW
HKGEEIDVLAYNNNKMIAFEVKWKDLSFKEAKGILRDLERKLDKVDFDGEKECYIIAKSI
EGKEKLKALDLMDLEKLIIF
Download sequence
Identical sequences Q57868
357474 MjR59 gi|15668601|ref|NP_247399.1| 243232.MJ0425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]