SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AAC98295 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AAC98295
Domain Number 1 Region: 580-824
Classification Level Classification E-value
Superfamily Caspase-like 7.78e-63
Family Caspase catalytic domain 0.0000359
Further Details:      
 
Domain Number 2 Region: 150-271
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000063
Family Spectrin repeat 0.012
Further Details:      
 
Weak hits

Sequence:  AAC98295
Domain Number - Region: 90-163
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.00785
Family HBL-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AAC98295
Sequence length 826
Comment $ SECSG $ SQ42520 $ PDBT3083 $
Sequence
MKIGWLLITICSGIITKCINAHSSPYQNANESAIDDAYFLVLIIPAVSVAIVLVVVIFLC
CPRQQIRSDNVIKLEEGVNDVIEENVTHVVSLREAKVSGMMTDLTRFRQEIFTKHLTFNS
NPESIDAATKNVQNVKQSLDTWRDRIKERLDEIDRLCTEEGDSLTPEQYSALREMRRQLA
DEYDTVLRTVEGIHTRLNILSALLIEFSSVTSSMQSWMTDRARLAGDIRHKSGDPMRVDE
ARFEAKSLMDEVVREESRLKTIGASVLKIEQEISAMRDDVRASRSTDDVGISMDEVYEKR
RRVEVDYMQLLRQCQDLISLQIRLHAMNDEHAEQARRAEGWLQMLKNDVAGVAKDPRFKK
DEDLIERDEELNRMAAGGSGGPTSRQLAMREKIEQREREEEEWRRKAKEKFEEEAAKNRA
RERKWAEEHGFNRPIRTRSQKYAEQDRIRYARKKAALEQSNEQSNESTDDAVESDSDDVP
APQSPPTPSPADPGPTTSSSSLTQDPASNATGFSDVPAPQAPPTPSPADPGPTTSSSSLT
QDPASNATGFSGSSPPNSFEETRMMCEDASDGKKIDETRKYRNNRSSKCRAIIINNVVFC
GMEKRIGSDKDKKKLSKLFERLGYQSTSYDNLKSSEILETVRQFTQSNHGDSLIITIMSH
GDQGLLYGVDGVPVQMLDIIDLMCTASLAKKPKWLMCVCCRGDRIDRAVRCDGFIDNFFD
RFPKFFQFMKSKFPSHQTSSSQADLLVSFSTSPGFLSFRDETKGTWYIQELYRVIIENAK
DTHLADLLMETNRRVVEKYEADKVVIVCKQAPEFWSRFTKQLFFDV
Download sequence
Identical sequences AAC98295 AAC98296 Y73B6BL.7 6239.Y73B6BL.7 Y73B6BL.7 Y73B6BL.7 NP_001023575.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]