SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for APC7488 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC7488
Domain Number 1 Region: 2-260
Classification Level Classification E-value
Superfamily Cgl1923-like 8.11e-88
Family Cgl1923-like 0.0000745
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) APC7488
Sequence length 334
Comment $ MCSG $ SQ131813 $ PDBT59102 $
Sequence
MIELEGVPELIDPVMVAAFEGWNDAGDAASTAVAHLDREWKGEVFAALDAEDYYDFQVNR
PTVWLDGGVRKITWPTTRLSVVRVGGEKPRDLVLVRGIEPSMRWRSFCNELLAFAHELGV
ELVVVLGALLGDTPHTRPVPVSGVTSDPDLARTMDLEETKYEGPTGIVGILQEACTHAGV
PAVSLWAAVPHYVSQPPNPKATLALLNRLEDLIDVRIPLGELPEDARAWQVGVDQLAAED
SEVAEYVQSLEEARDTAELPEASGEAIAREFERYLRRRDGGGPAAGGHATADGSDGTSYL
RDAPGGRTRPPKPPKPEAEDDGPADEGSDDSSED
Download sequence
Identical sequences Q828L9
APC7488 WP_010988050.1.19017 WP_010988050.1.30226 WP_010988050.1.49792 WP_010988050.1.60620 WP_010988050.1.68722 227882.SAV_6650 gi|29833192|ref|NP_827826.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]