SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0244.8 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0244.8
Domain Number 1 Region: 215-251
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000615
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 2 Region: 119-159
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000131
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 3 Region: 457-495
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000249
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 291-328
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000497
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 374-414
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000654
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 6 Region: 253-289
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000367
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 7 Region: 422-455
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000772
Family LDL receptor-like module 0.0019
Further Details:      
 
Weak hits

Sequence:  B0244.8
Domain Number - Region: 189-212
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000131
Family LDL receptor-like module 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B0244.8
Sequence length 551
Comment $ SECSG $ SQ53093 $ PDBT3198 $
Sequence
MSQQPGSARRVNFPEEPMTLGEKFSHRMDQLKEIIADGGCSRAAKCVSITVCLVLLVLIF
GGAIVYLVMSLTSSAQKMSADSMDISPQAIRHPKFWPPTDKIRFDDLNGIPMTSLFPQNV
STCSGFGFACTGAVHMVIPSSKRCDGRRDCEDGSDEENCKECQSVFSCKLRPEEESKKKG
RSTVQPTLICLTAQHLCDNVENCPDGSDEAVCKSSCSKDQFKCPGSNACLPLSAKCDGIN
DCADASDEKNCSKCQNNAHKCGKQCIKASHVCDGVAQCADGSDEQQCDCQRCSGTDKALC
DDGTCIMRTQVCDGKKDCTDGMDEEDCPGSCTIESFSPKLKMVTCSDGKQYTEAEACSGS
FESCDHDCPNSKCHPKLAFTCPASKEARKMCISRRKVCDGTPDCDDGADEINCTPIKECG
IAKNTQFKCDHKCLDSSRRCDGVWDCEDKSDEKGCDKCPSGTIKCAADKKCLPAFTRCNG
VADCSDGSDELKCSCQECLGVHSNTYMCNESNRCLKRDEVCSPYSMCPNATYTDKAFCAA
LFLKKSGTSPF
Download sequence
Identical sequences Q09967
B0244.8.1 B0244.8 6239.B0244.8 NP_498237.2.50509 B0244.8 B0244.8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]