SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for BtR275 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  BtR275
Domain Number 1 Region: 44-354
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 7.85e-50
Family Glycosyl hydrolases family 32 N-terminal domain 0.0068
Further Details:      
 
Domain Number 2 Region: 407-519
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000938
Family Glycosyl hydrolases family 32 C-terminal domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) BtR275
Sequence length 523
Comment $ NESG $ SQ141519 $ PDBT146332 $
Sequence
MMKNMILPIAFTALIASMTACSDETDPILTQKNWDGTATYFQSSDEHGFSMYYKPQVGFV
GDPMPFYDPVAKDFKVMYLQDYRPNPEATYHPIFGVATKDGATYESLGELISCGGRDEQD
AAIGTGGTIYNPADKLYYTFYTGNKFKPSSDQNAQVVMVATSPDFKTWTKNRTFYLKGDT
YGYDKNDFRDPFLFQTEDGVYHMLIATRKNGKGHIAEFTSADLKEWESAGTFMTMMWDRF
YECPDVFKMGDWWYLIYSEQASFMRKVQYFKGRTLEDLKATTANDAGIWPDNREGMLDSR
AFYAGKTASDGTNRYIWGWCPTRAGNDNGNVGDVEPEWAGNLVAQRLIQHEDGTLTLGVP
DAIDRKYTSAQEVKVMAKDGNMIESGKTYTLGEGASVIFNRLKVHNKISFTVKTASNTDR
FGISFVRGTDSASWYSIHVNADEGKANFEKDGDDAKYLFDNKFNIPADNEYRVTIYSDQS
VCVTYINDQLSFTNRIYQMQKNPWSLCCYKGEITVSDVQVSTY
Download sequence
Identical sequences A0A0P0F2Q3 C6IRF5 Q8A6W6
BtR275 NP_810673.1.73244 WP_008767781.1.24025 WP_008767781.1.28290 WP_008767781.1.97929 gi|29347170|ref|NP_810673.1| 226186.BT_1760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]