SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C17E7.8 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C17E7.8
Domain Number 1 Region: 131-370
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.75e-39
Family Nuclear receptor ligand-binding domain 0.0029
Further Details:      
 
Domain Number 2 Region: 12-88
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.34e-23
Family Nuclear receptor 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C17E7.8
Sequence length 376
Comment $ SECSG $ SQ52633 $ PDBT11205 $
Sequence
MSGTTISSDRPNICAICHQKAFGYNYEVVSCNACKMFFRRAHAEKIDDFCKKGGKCFDGD
DLLTSRPKCRSCRYKKCVNLGMRYHNSSESQTQSDEEPSPKQSVVAVVPQHIITQAHIDS
TFFQHLHALNETRYNAYCVINICEDPSFCDLVAQGSKLSVYLRPQEIEWENTERKLKPWG
SLGVLLAVEVCKGLSFYNDLLLSDRVLLLKNVAFKSHHLSVAYDSFIQKKGRVLAPTGTE
MFPDVLFEIPKCREIIMDLLTSPMKPLMELQITESEYLLLNMIVICNPAIQGMSPSGQDL
LSRHQQVYARILLQMCMVSNPRTGPGRYAAILAINQRLDRQSVITNRVVQCLREYWAPNF
FFSKILTEACRSDVYY
Download sequence
Identical sequences O16391
C17E7.8a C17E7.8 C17E7.8a NP_504070.2.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]