SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C53C9.3 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C53C9.3
Domain Number 1 Region: 216-468
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.71e-54
Family Voltage-gated potassium channels 0.00055
Further Details:      
 
Domain Number 2 Region: 71-177
Classification Level Classification E-value
Superfamily POZ domain 2.35e-19
Family Tetramerization domain of potassium channels 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C53C9.3
Sequence length 490
Comment $ SECSG $ SQ51473 $ PDBT11404 $
Sequence
MSTERLMYLDLNKGNQIAMVIPSTRKGHAASRDNFGNSNHHGDEIVHRLNNGRRSEIDEV
KPDLVSGAGDTVIKLNVGGTSFRIRISSIFARSADEKLSAFAQLNHEQRLQACDAFLMPQ
EEYYLERSAVLFDSIFKYYISGQLHRPLDVCPTEFATELAYWKINDGLMSNCCWRGYNMS
PSLEELVAPKEKKIELHDRSMRSRIHQFCEGDGSLFSTLFTFGSITFVLISVIGLVLGSI
HEFQVPIYKKGGKSERISNWSIVENENIIWEPHPIFGYVETVCIIWFTVEFIVRLAVTPN
RFQFLVGIMNIVDMIAIIPFYLELGLALFGIDVASLSDIKGALLVVRVLRVLRVVRILKL
GRYSSGMRTFALTLKSSARQLGMMGMVLSTGVVFFSTLLYFVEKDEKDTPFTSIPAAFWW
AIVTMTTVGYGDYVPVTVPGKLIASGAIISGVLVLALPITIIVDNFMKVSGNVNANIFSS
ANQRPIDVAE
Download sequence
Identical sequences H2KZE7
C53C9.3a C53C9.3 NP_001024489.1.50509 C53C9.3a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]