SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cth-1813 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cth-1813
Domain Number 1 Region: 42-448
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.01e-75
Family beta-glycanases 0.00000111
Further Details:      
 
Domain Number 2 Region: 497-564
Classification Level Classification E-value
Superfamily Type I dockerin domain 3.79e-18
Family Type I dockerin domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Cth-1813
Sequence length 566
Comment $ SECSG $ SQ52969 $ PDBT16106 $
Sequence
MKKAKAIFSLVVALMVLAIFCFAQNTGSTATTAAAAVDSNNDDWLHCKGNKIYDMYGNEV
WLTGANWFGFNCSENCFHGAWYDVKTILTSIADRGINLLRIPISTELLYSWMIGKPNPVS
SVTASNNPPYHVVNPDFYDPETDDVKNSMEIFDIIMGYCKELGIKVMIDIHSPDANNSGH
NYELWYGKETSTCGVVTTKMWIDTLVWLADKYKNDDTIIAFDLKNEPHGKRGYTAEVPKL
LAKWDNSTDENNWKYAAETCAKAILEVNPKVLIVIEGVEQYPKTEKGYTYDTPDIWGATG
DASPWYSAWWGGNLRGVKDYPIDLGPLNSQIVYSPHDYGPSVYAQPWFEKDFTMQTLLDD
YWYDTWAYIHDQGIAPILIGEWGGHMDGGKNQKWMTLLRDYIVQNRIHHTFWCINPNSGD
TGGLLGNDWSTWDEAKYALLKPALWQTKDGKFIGLDHKIPLGSKGISLGEYYGTPQASDP
PATPTATPTKPAASSTPSFIYGDINSDGNVNSTDLGILKRIIVKNPPASANMDAADVNAD
GKVNSTDYTVLKRYLLRSIDKLPHTT
Download sequence
Identical sequences Q05332
203119.Cthe_2872 gi|125975353|ref|YP_001039263.1| Cth-1813 WP_003514548.1.16390 WP_003514548.1.31213 WP_003514548.1.60145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]