SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EnhiA.01252.a from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EnhiA.01252.a
Domain Number 1 Region: 132-438
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.85e-95
Family Protein kinases, catalytic subunit 0.0000000944
Further Details:      
 
Domain Number 2 Region: 3-94
Classification Level Classification E-value
Superfamily PH domain-like 3.15e-30
Family Pleckstrin-homology domain (PH domain) 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EnhiA.01252.a
Sequence length 466
Comment $ SSGCID $ SQ185038 $ PDBT344696 $
Sequence
MDSVKSGFLVKQGGSWKSWKKRWCVLTPTGMIFYFKDKKDVNSKGCVDVNSASDVLLEDE
KKKNCFGIVTPNRTFFMAAESKAERDSWIQAVSRFVRNKNLSAMSGNSLQSSQEGIQSNS
NNNLTQNLGDGNTNSHSSEPHKVGVDDFEMLSLIGKGSFGKVMQVKEKATGQIYAMKILN
KTHIIDNNEIEHTMAEKNVLSKSKNPFLMQMHYSFQTPDKLYFILDYVNGGELFAHLQRE
HRFSIERTRFYAAELLIGLKYLHDAGIVYRDLKPENILLTDEGHVCITDFGLCKEGLTEK
DQTNTFCGTPEYLAPEILLGNGYGFAVDWWSYGTLIYEMLLGLPPFFDNDVQTMYQKIVS
DDVRFPKNTPPAIREFISALLQKDPEDRLTNPDIMMKHPFFKNMDFEMVKAKKIKPPFIP
NVTSKEDLAMISEEFLEETQEAIDEEKQYVPRNGGVDFSGFTYVGK
Download sequence
Identical sequences A0A175JR71 M2RX35 M3V0Y2 M7WYJ1 N9T9S7 Q761W9
gi|56472250|gb|EAL49749.1| gi|67479509|ref|XP_655136.1| XP_655136.1.49425 294381.C4M3J6 jCVI|EHI_138540 EnhiA.01252.a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]