SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F35E8.12 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F35E8.12
Domain Number 1 Region: 8-90
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.34e-23
Family Nuclear receptor 0.0012
Further Details:      
 
Domain Number 2 Region: 95-332
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.75e-21
Family Nuclear receptor ligand-binding domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F35E8.12
Sequence length 338
Comment $ SECSG $ SQ51364 $ PDBT10676 $
Sequence
MSKKSENQPCMVCGEISYSIRFGAVSCRACAEFFRRKIVSKARIPKRCNGACDLGKYHRK
TCQSCRFQKCLKIGMLEKVVASRTPVNRRSENNQTILSGLEKAYDKLENSRDNVFDRKNK
IPKYCNHQELDDMFEIDIKLISTHFIQFFESKSSLENNQNKVLSTHFIIRFSLLEVAFRA
FGKPTYILPNNDIIDVSKLDKVYQHLETGEDERGKNSQVILQRFWQMNEKTMKTEVFPVN
LDQSEFLFLCALIYWDFGIENQSEKCLEECQRMRTQVLKELTEYEKSNYPENELRVAQVI
GILQALQKTLDVIQHSGYISNVYNLKGKQCPLYEATNE
Download sequence
Identical sequences O45449
F35E8.12 F35E8.12 NP_506987.1.50509 6239.F35E8.12 F35E8.12 F35E8.12

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]