SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F36A2.4 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F36A2.4
Domain Number 1 Region: 388-572
Classification Level Classification E-value
Superfamily Fibronectin type III 1.01e-26
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 2 Region: 11-44,116-200
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.53e-24
Family Voltage-gated potassium channels 0.0042
Further Details:      
 
Domain Number 3 Region: 224-307
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.72e-18
Family Voltage-gated potassium channels 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F36A2.4
Sequence length 618
Comment $ SECSG $ SQ50709 $ PDBT6506 $
Sequence
MSIFQVENEKMARFLSLHVLLIGSVVLYIILGAIVFQMLEGEHLDALKKDHMAKIEQNAK
DYVDKLWSVAKRDRDKYKNVEDLIKSVKEDTVDDFNDYVDTVFYAHRAVRHGYDEDSPTW
DFANSVFFTTTMLTSIGYGYVAPSTFGGRLFGVIYCLIGIPLTLVTVANVAKFLSETIFF
LHYELWNKCLEWKRKRKGEVEADPLQPMFGDDENEEEILDRVRLVRFPPLTVFFFVFVYG
CIAAWVVRYWETWTYVESLYFIFISILTVGFGDIRPSPGNIWVTLAFVVVGVILTTMCMD
VVGRMYLKEIHYLGRKLKSSNPFYLLREAKARRRRAAMASLLAQLAKGMIFAHKDYNELA
RKKSKRKKEKRRGSHVLPNEKFMFARLPPDPPSDCQVVSTSAYSVRLAWAPPFSPDPDLT
YNIRYRLKHNEDAKVRELRGIKGNTVEIMSVDSCSLYEFRITAHNKFGESKAVYLVQYTE
PQLSPQHILATRLNANTIELTWEPPYKKSHEVKNYVVYFTENPNASLSEWEKIPVNGRRV
VFPDLRFDWFYMFSATAVFKDGQRSPLSRALFIKTDKIEFHKHCVGHSKTIDVMDSICEK
EDNETTALLKRDYVSFAV
Download sequence
Identical sequences F36A2.4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]