SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FR403 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FR403
Domain Number 1 Region: 1-103
Classification Level Classification E-value
Superfamily PDB 9.98e-46
Family PDB 0.0054
Further Details:      
 
Domain Number 2 Region: 2-135
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 2.21e-17
Family Ribosomal protein L14e 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) FR403
Sequence length 135
Comment $ NESG $ SQ108919 $ PDBT138991 $
Sequence
MRKIMKQGKIVIVLSGRYAGRKAIIVKTHDDGTPEKPFGHALVAGIDRYPRKVTKKMGKN
KLKKKSKVKPFLKSLNYNHLMPTRYTAHDISFEKLSPKDLKDPVKRKTHRFQTRVKFESV
YKEGKNKWFFQKLRF
Download sequence
Identical sequences B3P6G2 B4ICC8 B4QVD5 Q6XI04 Q9VBN5
FR403 FBpp0255685 FBpp0130773 FBpp0191704 4v6w_CZ FBpp0216582 FBpp0084306 FBpp0084306 FBpp0084306 FBpp0303778 FBpp0303779 FBpp0303780 7301368___KOG3418 NP_001262966.1.81976 NP_001262967.1.81976 NP_001262968.1.81976 NP_651417.1.81976 XP_001981762.1.56816 XP_002041286.1.34323 XP_002099003.1.41174 XP_016036293.1.80810 XP_016036294.1.80810 XP_016036295.1.80810 XP_016036296.1.80810 XP_016036297.1.80810 7227.FBpp0084306 7245.FBpp0255685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]