SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FR45 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FR45
Domain Number 1 Region: 80-258
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 9.02e-61
Family Brix domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) FR45
Sequence length 298
Comment $ NESG $ SQ29036 $ PDBT116454 $
Sequence
MLRKQARQRREYLYNKALTERLKSKQKIQETVVKSINENKAIGSKNVKKSLTAYKSLKYA
DEGVDDRTVNDEYHYAGCEDPKIMLTTSHNPSSRLKMFMKELRLIIPNAQQMNRGNYQLT
TLMHACRANNVTDFLIVHEHRGIPDSLVVCHLPYGPTAFFNISDVVMRHDIPDIGHMSEQ
KPHLIFNNFKTPIGLRTVKILKHLFPVPKENSQRVMSFLNHNDSIIFRHHQYKYVNKELE
LTEVGPRFSLKLYQIKLGTLENIKAADTEWINRPYMNTSQKRLIFSNDPGIINKDTEA
Download sequence
Identical sequences Q9VBY2
FR45 7227.FBpp0084144 FBpp0084144 NP_651335.2.81976 7301265___KOG2781 FBpp0084144 FBpp0084144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]