SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FR472 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FR472
Domain Number 1 Region: 283-332
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000471
Family RING finger domain, C3HC4 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) FR472
Sequence length 338
Comment $ NESG $ SQ119951 $ PDBT141338 $
Sequence
MEFLHESVALGVDLLILGLCAREYVHYKRTAKVLKAAPQYNIDGDLKSVVERQRDKKIPY
AVIRGTVTPIGVPLRSSLVPSVSGVLQIVKLHEHRVTRGFAGFWTEQHKLLHESANEMPF
ELRNQSHGVEIVDALSAAVLDVDVVYDNYEPSNLSLFDHVFGFFSGVRQRGLQTTEEVLR
EGSFLTAIGELELDGDTLRMQPSNEGPLFLTTATKSTLIKRFEDAKTTTILKLVVCSTIS
AILVAFIAKKLYRKRKQEREEAKIRERLDTERRERRARSRPHTLSQDQLCVVCSTNPKEI
ILLPCGHVCLCEDCAQKISVTCPVCRGSIVSKAAAFIA
Download sequence
Identical sequences Q9VZJ9
FBpp0073049 FR472 NP_001303365.1.81976 NP_647847.1.81976 FBpp0073049 FBpp0073049 7227.FBpp0073049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]