SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FR501 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FR501
Domain Number 1 Region: 13-261
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.51e-57
Family DNA replication initiator (cdc21/cdc54) N-terminal domain 0.0012
Further Details:      
 
Domain Number 2 Region: 300-501,547-655
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.85e-37
Family Extended AAA-ATPase domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) FR501
Sequence length 819
Comment $ NESG $ SQ119980 $ PDBT141367 $
Sequence
MAHEGEQFIKDIQREYVDFLDDEEDQGIYAGHVKDMIAEKSKRLIVNVNDLKRKNPQRAL
GLLSNAADEQLAFGRALKEYASTVDPGYAKMHEDLFVGFEGCFGNRHVTPRSLTSIYLGN
MVCVEGIVTKVSLIRPKVVRSVHYCPNTRKVMERKYTDLTSFEAVPSGAAYPTKDEDGNL
LETEYGLSVYKDHQTLTIQEMPEKAPAGQLPRSVDIVCDDDLVDRCKPGDRVQIVGSYRC
LPGKRGGYTSGTFRTVLLANNISLLSKESNLDISREDIMLCKKLAKNNDIFELLSKSLAP
SIHGHAYVKQAILCLLLGGVEKILPNGTRLRGDINVLLIGDPSVAKSQLLRYVLNTAPRA
IPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDIDRTAIHEV
MEQGRVTISKAGIHASLNARCSVLAAANPVYGRYDQYKTPMENIGLQDSLLSRFDLLFVM
LDVIDSDVDQMISDHVVRMHRYRNPKEADGEPLSMGSSYADSLSFVSSSEEKKDTEVYEK
YDALLHGKSRQRHEKILSVEFMRKYIHIAKCMKPKLGEQACEAIANEYSRLRSQEAVETD
VARTQPITARTLETLIRLSTAHARARMSKSVTIDDAHAAIELVQFAYFKKVLDKDRPSKR
RRNSGSDAEDDNGEASSQRSPSRRSKRTRTATVGADSDEEDIEPPQPDAGDLTRRETRRS
LPARSVAMLMASPSSEEQSVATSTTEPAIISDARLGEFKNNLQRLFREAREQSLALARIT
TAINVGSQEPFTAGEIEAAVHRMTEDNQIMVADDIVFLI
Download sequence
Identical sequences Q9XYU1
FR501 FBpp0070729 NP_511048.2.81976 FBpp0070729 FBpp0070729 7227.FBpp0070729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]