SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FR614 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FR614
Domain Number 1 Region: 5-106
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.13e-23
Family Cold shock DNA-binding domain-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) FR614
Sequence length 155
Comment $ NESG $ SQ141961 $ PDBT144263 $
Sequence
MSRRGLLLMGQCMPCIKQNASKIRIRRMELDKNLNMYFKKDEFYFAHDPQKVCKTGDVVL
IRELPERLTRLITHNVEKVVYPLGDITDPLTGKKVVVGNYREDIEMANQLFGKSEKAFDY
EKAPPRGRLEGTKDFTHGETYIKYHEDGKDQPFAV
Download sequence
Identical sequences Q9W199
7227.FBpp0072184 NP_525119.1.81976 FBpp0072184 FBpp0072184 FBpp0072184 FR614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]