SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FR707 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FR707
Domain Number 1 Region: 481-637
Classification Level Classification E-value
Superfamily TPR-like 1.26e-22
Family HAT/Suf repeat 0.057
Further Details:      
 
Domain Number 2 Region: 205-486
Classification Level Classification E-value
Superfamily TPR-like 1.57e-20
Family HAT/Suf repeat 0.028
Further Details:      
 
Domain Number 3 Region: 90-202
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000542
Family HAT/Suf repeat 0.02
Further Details:      
 
Domain Number 4 Region: 646-724
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000569
Family HAT/Suf repeat 0.091
Further Details:      
 
Domain Number 5 Region: 23-78
Classification Level Classification E-value
Superfamily TPR-like 0.000000024
Family HAT/Suf repeat 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) FR707
Sequence length 883
Comment $ NESG $ SQ151132 $ PDBT148295 $
Sequence
MVTKTIKSLNLEINFEVEDVPYEEEILRNAYSVKHWLRYIDHKAKAPNNGVNMVYERALK
ELPGSYKIWHNYLRTRRKQVRGKIPTDPMYEEVNSAFERALVFMHKMPRIWMDYGAFMTS
QCKITRTRHVFDRALRALPITQHGRIWPLYLQFVRRFEMPETALRVYRRYLKLFPEDTEE
YVDYLQEADRLDEAAQQLAHIVDNEHFVSKHGKSNHQLWNELCDLISKNPHKVHSLNVDA
IIRGGLRRYTDQLGHLWNSLADYYVRSGLFDRARDIYEEAIQTVTTVRDFTQVFDEYAQF
EELSLNRRMEQVAANEAATEEDDIDVELRLSRFEYLMERRLLLLNSVLLRQNPHNVHEWH
KRVTLYEDKPAEIISTYTEAVQTVQPKQAVGKLHTLWVEFAKFYEANGQVEDARVVFERG
TEVEYVKVEDLAAVWCEWAEMELRQQQFEAALKLMQRATAMPKRKIAYYDDTETVQARLH
RSLKVWSMYADLEESFGTFKTCKAVYERIIDLKICTPQIIINYGMFLEEHNYFEEAYRAY
EKGISLFKWPNVYDIWNSYLTKFLERYGGTKLERARDLFEQCLDQCPPEHAKYFYLLYAK
LEEEHGLARHAMSVYDRATSAVKEDEMFDMYNIFIKKAAEIYGLPRTREIYEKAIESLPE
QNMRHMCVKFAELETKLGEVDRARAIYAHCSQVCDPRITADFWQTWKEFEVRHGNEDTMR
EMLRIKRSVQATYNTQVNMMAAQFLSTNNGAAADAGAGAGPDAMRLLEEKARQAAAESKQ
KPIEKAASNIMFVRGETQGGAKDKKDTVVNPDEIDIGDSDEDDEEEDDDEENEMTNENQA
SAAVTKTDEEGLVMKKLRFEQKAIPAKVFGSLKPSNQGDSDGE
Download sequence
Identical sequences A1Z9G2
FBpp0086749 FR707 7227.FBpp0086749 NP_610891.1.81976 7303287___KOG2047 FBpp0086749 FBpp0086749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]