SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FR727 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FR727
Domain Number 1 Region: 401-642
Classification Level Classification E-value
Superfamily TPR-like 3.5e-25
Family Tetratricopeptide repeat (TPR) 0.01
Further Details:      
 
Weak hits

Sequence:  FR727
Domain Number - Region: 18-109
Classification Level Classification E-value
Superfamily TPR-like 0.00114
Family Tetratricopeptide repeat (TPR) 0.02
Further Details:      
 
Domain Number - Region: 151-190,347-409
Classification Level Classification E-value
Superfamily TPR-like 0.00588
Family Tetratricopeptide repeat (TPR) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) FR727
Sequence length 718
Comment $ NESG $ SQ151151 $ PDBT148719 $
Sequence
MPGDTENTSTDTTNEHIDLALYRQLVKQFIDMRRYSTALFWAEKVAVLGGLEPRDIYYQA
QCMYLLGEYHRAAHTIQHHKLEKNSLPCFNLLLESLYAAKEFTEAANVIQNVEVEVMTTS
LINQPVDASSGCYLESNSVFGGEENHRNELLSSIYLMKGKVYEALDNRGMAMDFYVQALH
KSIYCFEALEALVQHEMLMAWEEFELMHHLPLAQQSSEADAKFILKLYESRLKKYYELIS
ARNAEEMSPIVNPDILQFIKEFTARVQQSGSSDTQMPKVSAVKVPLTPSQFMSPAQKVLE
DLKAPTFSLQTSLSKASSLIDASHRSMFDSSSRRRSRDHDTDTLIPIAECLDRVQRSTDL
MAAEAEKCFYDCDYKQCLKILNELLKVDPFHNTALTIQIACLVENGDFNRLFYVAHKLVD
RYPDKAISWYAVGCYYDMIGKSDPARRYLSKATALDRLYGPAWLAYGHSFANENEHEQAM
AAYFKATQLMRGCHLPLLYIGVECGLTKNLELAEKFFLQAMNIAPLDVYVLHELGVIKYE
YEFFDGAATIFQCTVDIVKQRAKSNNEEISSRWEPLFINLGHSLRKVHKYEEALYNFQYA
LLLKPQSPTTYTSIGFIHALLGNLDPAIEAFHKSLALNRDCIVTSTILKSCIEDLMDDSA
TIDEICSAALRDVAKNITANSRRVLNSDKFNGMKLKFDEEEEFANSDSNMVVEMSFDT
Download sequence
Identical sequences Q9VCN6
FBpp0083769 FBpp0083769 NP_477397.1.81976 FR727 7227.FBpp0083769 FBpp0083769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]