SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FR735 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FR735
Domain Number 1 Region: 147-277,537-707
Classification Level Classification E-value
Superfamily TPR-like 7.21e-18
Family Tetratricopeptide repeat (TPR) 0.019
Further Details:      
 
Domain Number 2 Region: 446-567
Classification Level Classification E-value
Superfamily TPR-like 0.000000000664
Family Tetratricopeptide repeat (TPR) 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) FR735
Sequence length 852
Comment $ NESG $ SQ151158 $ PDBT148663 $
Sequence
MTSQITANGTQRLPEPVSEHEAVPPPPPTAAGRPRPPTSQLFSRGNLASSRATGGDKSGL
ARPSTAVRAVGYAANCESAHQRFEQFFLEKAKQQTLSSRAAVDAIKDVNPQMKYKNLEEK
IVKLLESSIVLAWQGSPNKLLNLDTKLAEALSKAKEAFSLDRTLHQFRDQHGENVYHNFD
LTYAQYERSEMHIEALNTYSIMAKNKMFPHVNQLKLNMGNIYYSMGIYQKAVKMYRMALD
SVPKSLSQLRLKIRENIGILFIRMGSYSDAASSFEFIMTERANIRSSIHLLLCYFALGDV
EKVKLAFRRLCDVQTEAIESDMESETNIIKLQQQAEPIQQIGETDGYQSLNNEPVTGSVI
KAEGGGKLNETVKFAATVKHRYVVQALKKDELAVYRNERRNAVKRSITMIVDLISPFIED
NYNDGYNWCIEIIKTSNLAWLANELELNKALVYLRQNDVHQAIETLQMYDRKSEGSMTAS
ALTNLSFIYIKMASHCVNQLHEIGSLKNNAPGLINAGIVELGSHNLILASERFEGALQLQ
PMNFEARYNLGLVALAQNDYELAEERFELLKEQLMLPSSVQHSHVFYQLAKLQERRLESG
LISNFTPGAALQAYLQVVGISASDIDSRLFEKVGSLYEQIQDHQEANQYYNEAYRINMSD
IGIASSIGSYYIKLQATERALFYYERAVLADPNDPNLMLRIASCFRNSYLPTKQYLGLFQ
KIHARFPDNLTCIRALMQVTKSLELGDLYERYASEYTRLQSQQQERQSEQRYQQQRFPSA
AKFTIRQSNEEHLKEVGENFNSVVHTQSPYTSILQFDPLGPPAERPKTGRPLQSRDDVDD
DAEMNPESLLPI
Download sequence
Identical sequences FBpp0085279 FBpp0085279 7227.FBpp0085279 FR735 FBpp0085279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]