SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GO.11625 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.11625
Domain Number 1 Region: 22-165
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.61e-30
Family N-acetyl transferase, NAT 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GO.11625
Sequence length 190
Comment $ CESG $ SQ2738 $ PDBT202424 $
Sequence
MEKEMEDKEEFDEGEIEYTSYAGEHHLPLIMSLVDQELSEPYSIFTYRYFVYLWPQLCFL
AFHKGKCVGTIVCKMGDHRQTFRGYIAMLVVIKPYRGRGIASELVTRAIKAMMESGCEEV
TLEAEVSNKGALALYGRLGFIRAKRLYHYYLNGMDAFRLKLLFPKPRVPQIPSQVQTQQE
YETFPRPRVP
Download sequence
Identical sequences O80438
NP_181348.1.80155 NP_973629.1.80155 3702.AT2G38130.2-P GO.11625 AT2G38130.1 AT2G38130.2 AT2G38130.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]