SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GO.34620 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.34620
Domain Number 1 Region: 28-120
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.91e-22
Family Ras-binding domain, RBD 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GO.34620
Sequence length 435
Comment $ CESG $ SQ5595 $ PDBT204613 $
Sequence
MAPFGRNLLKTRHKNRSPTKDMDPEEKEIVVWVCQDEKIVCGLTKRTTSIDVIQALLEEH
EATFGEKRFLLGKASDYCIVEKWRGSERALPPLTRILKLWKAWGDEQPNMQFVLVKTDAF
LPVPLWRTAETKLVQNNEKPWELSPANYMKTLPPDKQKRIVRKTFRKLAKIRQDTSSHDR
DNMECLVHLIISQDHTIHQQVQRMKELDMEIEKCEAKIHLDRVGNDGANYVHEAYLMPRL
SDEEQKLDIQAEINQTLEDLNDSEGMAQLEEQLQYYRALIDKLSAEIEREVKGAGIDGIE
DMEGAAACELENSDLESVKCDLETSMKAGLTIHSHLSGIQREIKYSDSLLQMKAREYELL
AKEFSSLHISNKDGCQGKENRGKEAEAPSSNGETPPLTQRVFNIYTNDTDSDTGISSNHS
QDSETTLGDVLLLAT
Download sequence
Identical sequences Q8K342
NP_666352.1.92730 ENSMUSP00000054767 ENSMUSP00000054767 ENSMUSP00000054767 10090.ENSMUSP00000054767 GO.34620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]