SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GO.35480 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.35480
Domain Number 1 Region: 592-660
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000101
Family HLH, helix-loop-helix DNA-binding domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GO.35480
Sequence length 706
Comment $ CESG $ SQ6322 $ PDBT206507 $
Sequence
MNPQQQRMAAIGTDKELSDLLDFSAMFSPPVNSGKTRPTTLGSSQFSGSGIDERGGTTSW
GTSGQPSPSYDSSRGFTDSPHYSDHLNDSRLGAHEGLSPTPFMNSNLMGKTSERGSFSLY
SRDTGLPGCQSSLLRQDLGLGSPAQLSSSGKPGTAYYSFSATSSRRRPLHDSAALDPLQA
KKVRKVPPGLPSSVYAPSPNSDDFNRESPSYPSPKPPTSMFASTFFMQDGTHNSSDLWSS
SNGMSQPGFGGILGTSTSHMSQSSSYGNLHSHDRLSYPPHSVSPTDINTSLPPMSSFHRG
STSSSPYVAASHTPPINGSDSILGTRGNAAGSSQTGDALGKALASIYSPDHTSSSFPSNP
STPVGSPSPLTGTSQWPRPGGQAPSSPSYENSLHSLKNRVEQQLHEHLQDAMSFLKDVCE
QSRMEDRLDRLDDAIHVLRNHAVGPSTSLPAGHSDIHSLLGPSHNAPIGSLNSNYGGSSL
VASSRSASMVGTHREDSVSLNGNHSVLSSTVTTSSTDLNHKTQENYRGGLQSQSGTVVTT
EIKTENKEKDENLHEPPSSDDMKSDDESSQKDIKVSSRGRTSSTNEDEDLNPEQKIEREK
ERRMANNARERLRVRDINEAFKELGRMCQLHLKSEKPQTKLLILHQAVAVILSLEQQVRE
RNLNPKAACLKRREEEKVSAVSAEPPTTLPGTHPGLSETTNPMGHM
Download sequence
Identical sequences A0A024R5Z0
ENSP00000331057 ENSP00000388940 ENSP00000331057 ENSP00000388940 9606.ENSP00000331057 NP_001309080.1.87134 NP_001309080.1.92137 NP_001309088.1.87134 NP_001309088.1.92137 NP_001309091.1.87134 NP_001309091.1.92137 NP_996919.1.87134 NP_996919.1.92137 NP_996920.1.87134 NP_996920.1.92137 GO.35480 gi|46370080|ref|NP_996919.1| gi|46370082|ref|NP_996920.1| ENSP00000331057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]