SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GO.39589 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.39589
Domain Number 1 Region: 90-133
Classification Level Classification E-value
Superfamily Orange domain-like 0.000000000314
Family Hairy Orange domain 0.0055
Further Details:      
 
Domain Number 2 Region: 17-78
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000393
Family HLH, helix-loop-helix DNA-binding domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GO.39589
Sequence length 224
Comment $ CESG $ SQ128702 $ PDBT202115 $
Sequence
MAPPAAPGRDRVGREDEDGWETRGDRKARKPLVEKKRRARINESLQELRLLLAGAEVQAK
LENAEVLELTVRRVQGVLRGRAREREQLQAEASERFAAGYIQCMHEVHTFVSTCQAIDAT
VAAELLNHLLESMPLREGSSFQDLLGDALAGPPRAPGRSGWPAGGAPGSPIPSPPGPGDD
LCSDLEEAPEAELSQAPAEGPDLVPAALGSLTTAQIARSVWRPW
Download sequence
Identical sequences Q96HZ4
ENSP00000272937 GO.39589 gi|21361763|ref|NP_061115.2| ENSP00000272937 9606.ENSP00000272937 NP_061115.2.87134 NP_061115.2.92137 ENSP00000272937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]