SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GO.4500 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.4500
Domain Number 1 Region: 74-133
Classification Level Classification E-value
Superfamily DNA-binding domain 1.5e-22
Family GCC-box binding domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GO.4500
Sequence length 262
Comment $ CESG $ SQ1642 $ PDBT209149 $
Sequence
MCGGAVISDYIAPEKIARSSGKSSWRSNGVFDCSIYDFDGNFDELESDEPFVFSSTHKHH
ASGSASDGKKKQSSRYKGIRRRPWGRWAAEIRDPIKGVRVWLGTFNTAEEAARAYDLEAK
RIRGAKAKLNFPNESSGKRKAKAKTVQQVEENHEADLDVAVVSSAPSSSCLDFLWEENNP
DTLLIDTQWLEDIIMGDANKKHEPNDSEEANNVDASLLSEELLAFENQTEYFSQMPFTEG
NCDSSTSLSSLFDGGNDMGLWS
Download sequence
Identical sequences A0A178W8F1 F4IDA7
3702.AT1G72360.2-P NP_001077812.1.80155 GO.4500 AT1G72360.2 AT1G72360.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]