SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GO.55802 from TargetDB

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  GO.55802
Domain Number - Region: 43-136
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0785
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GO.55802
Sequence length 278
Comment $ CESG $ SQ7132 $ PDBT204063 $
Sequence
MTDLNKHIKQAQTQRKQLLEESRELHREKLLVQAENRFFLEYLTNKTEEYTEQPEKVWNS
YLQKSGEIERRRQESASRYAEQISVLKTALLQKENIQSSLKRKLQAMRDIAILKEKQEKE
IQTLQEETKKVQAETASKTREVQAQLLQEKRLLEKQLSEPDRRLLGKRKRRELNMKAQAL
KLAAKRFIFEYSCGINRENQQFKKELLQLIEQAQKLTATQSHLENRKQQLQQEQWYLESL
IQARQRLQGSHNQCLNRQDVPKTTPSLPQGTKSRINPK
Download sequence
Identical sequences Q6ZUS5
ENSP00000339087 ENSP00000339087 gi|39979626|ref|NP_078860.2| NP_078860.2.87134 NP_078860.2.92137 GO.55802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]