SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GO.59641 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.59641
Domain Number 1 Region: 28-285
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 7.33e-126
Family MioX-like 0.000000000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GO.59641
Sequence length 285
Comment $ CESG $ SQ7214 $ PDBT205847 $
Sequence
MKVDLGPDPSLVYRPDVDPEMAKSKGSFRNYTSGPLLDRVFTTYKLMHTHQTVDFVMRKR
IQFGSFSYKKMTVMEAVDMLDDLVDESDPDVDFPNSFHAFQTAEGIRKAHPDKDWFHLVG
LLHDLGKILALWGEPQWAVVGDTFPVGCRPQASVVFCDSTFQDNPDLQDPRYSTELGMYQ
PHCGLENVLMSWGHDEYLYQMMKFNKFSLPSEAFYMVRFHSFYPWHTGGDYRQLCSQQDL
DMLPWVQEFNKFDLYTKCPDLPEVKSLRPYYQGLIDKYCPGILSW
Download sequence
Identical sequences Q9QXN4
10116.ENSRNOP00000011941 NP_665714.2.100692 NP_665714.2.4139 ENSRNOP00000011941 ENSRNOP00000011941 GO.59641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]