SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GO.79999 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.79999
Domain Number 1 Region: 22-85
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000000381
Family TBP-associated factors, TAFs 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GO.79999
Sequence length 177
Comment $ CESG $ SQ93838 $ PDBT202951 $
Sequence
MKNFNDEEHNSQLTDEVLPEPEDARVIANILKAVGVESFDTRVVAQLVEFVYKYIGEVLE
LSKTFAQYAEREDIRQDDVKLAISSLLSKSFTQPPSRDVLLQLCRERNAVPLPVVDTYVG
IQLPPKEFQLTTRNYQLKRKTTTESVASQELSEATGNISIGESSLQPNEEESNTMNT
Download sequence
Identical sequences GO.79999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]