SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GO.93234 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.93234
Domain Number 1 Region: 145-234
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.02e-25
Family Thioltransferase 0.00032
Further Details:      
 
Domain Number 2 Region: 2-106
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.98e-23
Family Thioltransferase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GO.93234
Sequence length 244
Comment $ CESG $ SQ149462 $ PDBT207859 $
Sequence
MTVVEIKSQDQFTQLTTTNAANKLIVLYFKAQWADPCKTMSQVLEAVSEKVRQEDVRFLS
IDADEHPEISDLFEIAAVPYFVFIQNGTIVKEISAADPKEFVKSLEILSNASASLANNAK
GPKSTSDEESSGSSDDEEDETEEEINARLVKLVQAAPVMLFMKGSPSEPKCGFSRQLVGI
LREHQIRFGFFDILRDENVRQSLKKFSDWPTFPQLYINGEFQGGLDIIKESIEEDPEYFQ
HALQ
Download sequence
Identical sequences N1P5G5 P32642
YER174C GO.93234 YER174C YER174C YER174C NP_011101.3.97178 YER174C YER174C YER174C 4932.YER174C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]