SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HR3143 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HR3143
Domain Number 1 Region: 478-591
Classification Level Classification E-value
Superfamily SH2 domain 6.46e-31
Family SH2 domain 0.000000631
Further Details:      
 
Domain Number 2 Region: 163-256
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.45e-28
Family Ras-binding domain, RBD 0.00019
Further Details:      
 
Domain Number 3 Region: 283-414
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000112
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HR3143
Sequence length 594
Comment $ NESG $ SQ92139 $ PDBT131484 $
Sequence
MALAGCPDSFLHHPYYQDKVEQTPRSQQDPAGPGLPAQSDRLANHQEDDVDLEALVNDMN
ASLESLYSACSMQSDTVPLLQNGQHARSQPRASGPPRSIQPQVSPRQRVQRSQPVHILAV
RRLQEEDQQFRTSSLPAIPNPFPELCGPGSPPVLTPGSLPPSQAAAKQDVKVFSEDGTSK
VVEILADMTARDLCQLLVYKSHCVDDNSWTLVEHHPHLGLERCLEDHELVVQVESTMASE
SKFLFRKNYAKYEFFKNPMNFFPEQMVTWCQQSNGSQTQLLQNFLNSSSCPEIQGFLHVK
ELGKKSWKKLYVCLRRSGLYCSTKGTSKEPRHLQLLADLEDSNIFSLIAGRKQYNAPTDH
GLCIKPNKVRNETKELRLLCAEDEQTRTCWMTAFRLLKYGMLLYQNYRIPQQRKALLSPF
STPVRSVSENSLVAMDFSGQTGRVIENPAEAQSAALEEGHAWRKRSTRMNILGSQSPLHP
STLSTVIHRTQHWFHGRISREESHRIIKQQGLVDGLFLLRDSQSNPKAFVLTLCHHQKIK
NFQILPCEDDGQTFFSLDDGNTKFSDLIQLVDFYQLNKGVLPCKLKHHCIRVAL
Download sequence
Identical sequences Q13322
9606.ENSP00000381793 gi|48762679|ref|NP_005302.3| ENSP00000381793 ENSP00000385770 HR3143 NP_005302.3.87134 NP_005302.3.92137 XP_011513606.1.92137 XP_016867535.1.92137 ENSP00000381790 ENSP00000381793 ENSP00000385770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]