SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HR3573 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HR3573
Domain Number 1 Region: 12-323
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.03e-81
Family Protein kinases, catalytic subunit 0.000000758
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HR3573
Sequence length 721
Comment $ NESG $ SQ135463 $ PDBT169512 $
Sequence
MAEKFESLMNIHGFDLGSRYMDLKPLGCGGNGLVFSAVDNDCDKRVAIKKIVLTDPQSVK
HALREIKIIRRLDHDNIVKVFEILGPSGSQLTDDVGSLTELNSVYIVQEYMETDLANVLE
QGPLLEEHARLFMYQLLRGLKYIHSANVLHRDLKPANLFINTEDLVLKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQ
MQLILESIPVVHEEDRQELLSVIPVYIRNDMTEPHKPLTQLLPGISREALDFLEQILTFS
PMDRLTAEEALSHPYMSIYSFPMDEPISSHPFHIEDEVDDILLMDETHSHIYNWERYHDC
QFSEHDWPVHNNFDIDEVQLDPRALSDVTDEEEVQVDPRKYLDGDREKYLEDPAFDTNYS
TEPCWQYSDHHENKYCDLECSHTCNYKTRSSSYLDNLVWRESEVNHYYEPKLIIDLSNWK
EQSKEKSDKKGKSKCERNGLVKAQIALEEASQQLAGKEREKNQGFDFDSFIAGTIQLSSQ
HEPTDVVDKLNDLNSSVSQLELKSLISKSVSQEKQEKGMANLAQLEALYQSSWDSQFVSG
GEDCFFINQFCEVRKDEQVEKENTYTSYLDKFFSRKEDTEMLETEPVEDGKLGERGHEEG
FLNNSGEFLFNKQLESIGIPQFHSPVGSPLKSIQATLTPSAMKSSPQIPHQTYSSILKHL
N
Download sequence
Identical sequences G1R3W5 H2Q9G3 Q16659
9598.ENSPTRP00000012102 9606.ENSP00000261845 ENSNLEP00000007887 gi|4506091|ref|NP_002739.1| NP_002739.1.87134 NP_002739.1.92137 XP_005254594.1.92137 XP_005254595.1.92137 XP_005254596.1.92137 XP_008951419.1.60992 XP_009427409.1.37143 XP_009427410.1.37143 XP_011520084.1.92137 XP_012362879.1.23891 XP_510409.2.37143 ENSP00000261845 ENSP00000261845 ENSPTRP00000012102 ENSPTRP00000012102 ENSNLEP00000007887 HR3573 hsk003000011.1 ENSP00000261845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]