SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HR3603 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HR3603
Domain Number 1 Region: 242-343
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.11e-29
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0000114
Further Details:      
 
Domain Number 2 Region: 96-207
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.49e-17
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.027
Further Details:      
 
Domain Number 3 Region: 15-69
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000113
Family HLH, helix-loop-helix DNA-binding domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HR3603
Sequence length 826
Comment $ NESG $ SQ197969 $ PDBT159193 $
Sequence
MEGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASVM
RLTISYLRVRKLLDAGDLDIEDDMKAQMNCFYLKALDGFVMVLTDDGDMIYISDNVNKYM
GLTQFELTGHSVFDFTHPCDHEEMREMLTHRNGLVKKGKEQNTQRSFFLRMKCTLTSRGR
TMNIKSATWKVLHCTGHIHVYDTNSNQPQCGYKKPPMTCLVLICEPIPHPSNIEIPLDSK
TFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFTKGQV
TTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDLIFSLQQTECV
LKPVESSDMKMTQLFTKVESEDTSSLFDKLKKEPDALTLLAPAAGDTIISLDFGSNDTET
DDQQLEEVPLYNDVMLPSPNEKLQNINLAMSPLPTAETPKPLRSSADPALNQEVALKLEP
NPESLELSFTMPQIQDQTPSPSDGSTRQSSPEPNSPSEYCFYVDSDMVNEFKLELVEKLF
AEDTEAKNPFSTQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLESSSASPESASPQSTVT
VFQQTQIQEPTANATTTTATTDELKTVTKDRMEDIKILIASPSPTHIHKETTSATSSPYR
DTQSRTASPNRAGKGVIEQTEKSHPRSPNVLSVALSQRTTVPEEELNPKILALQNAQRKR
KMEHDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLAC
RLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN
Download sequence
Identical sequences D0VY79 Q16665
ENSP00000338018 HR3603 gi|4504385|ref|NP_001521.1| 9606.ENSP00000338018 NP_001521.1.87134 NP_001521.1.92137 XP_003831675.1.60992 ENSP00000338018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]