SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HR4673 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HR4673
Domain Number 1 Region: 23-129
Classification Level Classification E-value
Superfamily PH domain-like 1.97e-22
Family Pleckstrin-homology domain (PH domain) 0.0057
Further Details:      
 
Domain Number 2 Region: 449-555
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000152
Family SH2 domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HR4673
Sequence length 561
Comment $ NESG $ SQ5801 $ PDBT165658 $
Sequence
MAAEEMHWPVPMKAIGAQNLLTMPGGVAKAGYLHKKGGTQLQLLKWPLRFVIIHKRCVYY
FKSSTSASPQGAFSLSGYNRVMRAAEETTSNNVFPFKIIHISKKHRTWFFSASSEEERKS
WMALLRREIGHFHEKKDLPLDTSDSSSDTDSFYGAVERPVDISLSPYPTDNEDYEHDDED
DSYLEPDSPEPGRLEDALMHPPAYPPPPVPTPRKPAFSDMPRAHSFTSKGPGPLLPPPPP
KHGLPDVGLAAEDSKRDPLCPRRAEPCPRVPATPRRMSDPPLSTMPTAPGLRKPPCFRES
ASPSPEPWTPGHGACSTSSAAIMATATSRNCDKLKSFHLSPRGPPTSEPPPVPANKPKFL
KIAEEDPPREAAMPGLFVPPVAPRPPALKLPVPEAMARPAVLPRPEKPQLPHLQRSPPDG
QSFRSFSFEKPRQPSQADTGGDDSDEDYEKVPLPNSVFVNTTESCEVERLFKATSPRGEP
QDGLYCIRNSSTKSGKVLVVWDETSNKVRNYRIFEKDSKFYLEGEVLFVSVGSMVEHYHT
HVLPSHQSLLLRHPYGYTGPR
Download sequence
Identical sequences P78314
gi|170014703|ref|NP_003014.3| gi|170014705|ref|NP_001116153.1| ENSP00000348685 ENSP00000403231 ENSP00000409746 ENSP00000424846 9606.ENSP00000348685 ENSP00000348685 ENSP00000403231 ENSP00000409746 ENSP00000424846 GO.34925 HR4673 NP_001116153.1.87134 NP_001116153.1.92137 NP_003014.3.87134 NP_003014.3.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]