SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HR5234 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HR5234
Domain Number 1 Region: 34-255
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.05e-55
Family Ankyrin repeat 0.00029
Further Details:      
 
Weak hits

Sequence:  HR5234
Domain Number - Region: 648-751
Classification Level Classification E-value
Superfamily Tropomyosin 0.00288
Family Tropomyosin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HR5234
Sequence length 823
Comment $ NESG $ SQ120167 $ PDBT141540 $
Sequence
MKLFGFGSRRGQTAQGSIDHVYTGSGYRIRDSELQKIHRAAVKGDAAEVERCLARRSGEL
DALDKQHRTALHLACASGHVQVVTLLVNRKCQIDVCDKENRTPLIQAVHCQEEACAVILL
EHGANPNLKDIYGNTALHYAVYSESTSLAEKLLSHGAHIEALDKDNNTPLLFAIICKKEK
MVEFLLKKKASSHAVDRLRRSALMLAVYYDSPGIVNILLKQNIDVFAQDMCGRDAEDYAI
SHHLTKIQQQILEHKKKILKKEKSDVGSSDESAVSIFHELRVDSLPASDDKDLNVATKQC
VPEKVSEPLPGSSHEKGNRIVNGQGEGPPAKHPSLKPSTEVEDPAVKGAVQRKNVQTLRA
EQALPVASEEEQQRHERSEKKQPQVKEGNNTNKSEKIQLSENICDSTSSAAAGRLTQQRK
IGKTYPQQFPKKLKEEHDRCTLKQENEEKTNVNMLYKKNREELERKEKQYKKEVEAKQLE
PTVQSLEMKSKTARNTPNWDFHNHEEMKGLMDENCILKADIAILRQEICTMKNDNLEKEN
KYLKDIKIVKETNAALEKYIKLNEEMITETAFRYQQELNDLKAENTRLNAELLKEKESKK
RLEADIESYQSRLAAAISKHSESVKTERNLKLALERTQDVSVQVEMSSAISKVKDENEFL
TEQLSETQIKFNALKDKFRKTRDSLRKKSLALETVQNNLSQTQQQTQEMKEMYQNAEAKV
NNSTGKWNCVEERICHLQRENAWLVQQLDDVHQKEDHKEIVTNIQRGFIESGKKDFVLEE
KSKKLMNECDHLKESLFQYEREKTEVVVSIKEDKYFQTSRKKI
Download sequence
Identical sequences Q4UJ75
ENSP00000349891 9606.ENSP00000349891 ENSP00000349891 ENSP00000349891 gi|149363679|ref|NP_001092275.1| NP_001092275.1.92137 HR5234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]