SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HR5395 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HR5395
Domain Number 1 Region: 438-683
Classification Level Classification E-value
Superfamily vWA-like 5.41e-70
Family Trunk domain of Sec23/24 0.00012
Further Details:      
 
Domain Number 2 Region: 198-455
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 1.49e-38
Family beta-sandwich domain of Sec23/24 0.0048
Further Details:      
 
Domain Number 3 Region: 686-781
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 2.62e-36
Family beta-sandwich domain of Sec23/24 0.0016
Further Details:      
 
Domain Number 4 Region: 888-1029
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 1.02e-33
Family C-terminal, gelsolin-like domain of Sec23/24 0.0015
Further Details:      
 
Domain Number 5 Region: 782-887
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 5.1e-29
Family Helical domain of Sec23/24 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HR5395
Sequence length 1033
Comment $ NESG $ SQ120314 $ PDBT141701 $
Sequence
MSQQGYVATPPYSQPQPGIGLSPPHYGHYGDPSHTASPTGMMKPAGPLGATATRGMLPPG
PPPPGPHQFGQNGAHATGHPPQRFPGPPPVNNVASSHAPYQPSAQSSYPGPISTSSVTQL
GSQLSAMQINSYGSGMAPPSQGPPGPLSATSLQTPPRPPQPSILQPGSQVLPPPPTTLNG
PGASPLPLPMYRPDGLSGPPPPNAQYQPPPLPGQTLGAGYPPQQAANSGPQMAGAQLSYP
GGFPGGPAQMAGPPQPQKKLDPDSIPSPIQVIENDRASRGGQVYATNTRGQIPPLVTTDC
MIQDQGNASPRFIRCTTYCFPCTSDMAKQAQIPLAAVIKPFATIPSNESPLYLVNHGESG
PVRCNRCKAYMCPFMQFIEGGRRYQCGFCNCVNDVPPFYFQHLDHIGRRLDHYEKPELSL
GSYEYVATLDYCRKSKPPNPPAFIFMIDVSYSNIKNGLVKLICEELKTMLEKIPKEEQEE
TSAIRVGFITYNKVLHFFNVKSNLAQPQMMVVTDVGEVFVPLLDGFLVNYQESQSVIHNL
LDQIPDMFADSNENETVFAPVIQAGMEALKAADCPGKLFIFHSSLPTAEAPGKLKNRDDK
KLVNTDKEKILFQPQTNVYDSLAKDCVAHGCSVTLFLFPSQYVDVASLGLVPQLTGGTLY
KYNNFQMHLDRQQFLNDLRNDIEKKIGFDAIMRVRTSTGFRATDFFGGILMNNTTDVEMA
AIDCDKAVTVEFKHDDKLSEDSGALIQCAVLYTTISGQRRLRIHNLGLNCSSQLADLYKS
CETDALINFFAKSAFKAVLHQPLKVIREILVNQTAHMLACYRKNCASPSAASQLILPDSM
KVLPVYMNCLLKNCVLLSRPEISTDERAYQRQLVMTMGVADSQLFFYPQLLPIHTLDVKS
TMLPAAVRCSESRLSEEGIFLLANGLHMFLWLGVSSPPELIQGIFNVPSFAHINTDMTLL
PEVGNPYSQQLRMIMGIIQQKRPYSMKLTIVKQREQPEMVFRQFLVEDKGLYGGSSYVDF
LCCVHKEICQLLN
Download sequence
Identical sequences HR5395 NP_001304995.1.87134 NP_001304995.1.92137 XP_005263436.1.92137 ENSP00000425491 ENSP00000369059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]