SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HR6009 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HR6009
Domain Number 1 Region: 154-273
Classification Level Classification E-value
Superfamily DNA clamp 1.42e-43
Family SCOPe 0.088
Further Details:      
 
Domain Number 2 Region: 19-140
Classification Level Classification E-value
Superfamily DNA clamp 2.03e-31
Family SCOPe 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HR6009
Sequence length 282
Comment $ NESG $ SQ43421 $ PDBT155534 $
Sequence
MPLLTQQIQDEDDQYSLVASLDNVRNLSTILKAIHFREHATCFATKNGIKVTVENAKCVQ
ANAFIQAGIFQEFKVQEESVTFRINLTVLLDCLSIFGSSPMPGTLTALRMCYQGYGYPLM
LFLEEGGVVTVCKINTQEPEETLDFDFCSTNVINKIILQSEGLREAFSELDMTSEVLQIT
MSPDKPYFRLSTFGNAGSSHLDYPKDSDLMEAFHCNQTQVNRYKISLLKPSTKALVLSCK
VSIRTDNRGFLSLQYMIRNEDGQICFVEYYCCPDEEVPESES
Download sequence
Identical sequences A0A024R045 A0A096NXH9 A0A2J8WB12 A0A2K5R6Y2 G3QNL8 H2QQR0 O60671 Q5R7X9
ENSGGOP00000004135 ENSPPYP00000017189 ENSGGOP00000004135 ENSP00000340879 ENSP00000371469 3g65_B 3ggr_C ENSPTRP00000028778 gi|4506385|ref|NP_002844.1| ENSP00000313467 NP_001126246.1.23681 NP_002844.1.87134 NP_002844.1.92137 XP_004059017.1.27298 XP_008954408.1.60992 XP_009238895.1.23681 XP_016808243.1.37143 XP_016808244.1.37143 XP_017403776.1.71028 XP_018868783.1.27298 XP_018868785.1.27298 ENSP00000340879 ENSP00000371469 9598.ENSPTRP00000028778 9600.ENSPPYP00000017189 9606.ENSP00000340879 cath|current|3g65B00/15-275 cath|current|3ggrC00/13-276 ENSPPYP00000017189 HR6009 O60671 ENSPTRP00000028778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]