SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HR6141 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HR6141
Domain Number 1 Region: 179-408
Classification Level Classification E-value
Superfamily RNI-like 2.55e-20
Family 28-residue LRR 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HR6141
Sequence length 476
Comment $ NESG $ SQ188686 $ PDBT157240 $
Sequence
MSIRTPPRLLELAGRSLLRDQALAMSTLEELPTELFPPLFMEAFSRRRCEALKLMVQAWP
FRRLPLRPLIKMPCLEAFQAVLDGLDALLTQGVHPRRWKLQVLDLQDVCENFWMVWSEAM
ARGCFLNAKRNKTPVQDCPRMRGQQPLTVFVELWLKNRTLDEYLTCLLLWVKQRKDLLHL
CCKKLKILGMPFRNIRSILKMVNLDCIQEVEVNCKWVLPILTQFTPYLGHMRNLQKLVLS
HMDVSRYVSPEQKKEIVTQFTTQFLKLCCLQKLSMNSVSFLEGHLDQLLSCLKTSLKVLT
ITNCVLLESDLKHLSQCPSISQLKTLDLSGIRLTNYSLVPLQILLEKVAATLEYLDLDDC
GIIDSQVNAILPALSRCFELNTFSFCGNPISMATLENLLSHTIILKNLCVELYPAPRESY
DADGTLCWSRFAQIRAELMKRVRDLRHPKRILFCTDCCPDCGNRSFYDLEADQCCC
Download sequence
Identical sequences Q5VXH4
HR6141 9606.ENSP00000347211 ENSP00000347211 ENSP00000365360 ENSP00000401281 gi|58219004|ref|NP_001010889.1| ENSP00000365353 NP_001010889.1.87134 NP_001010889.1.92137 ENSP00000347211 ENSP00000365360 ENSP00000401281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]