SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HR6148 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HR6148
Domain Number 1 Region: 162-424
Classification Level Classification E-value
Superfamily RNI-like 6.08e-19
Family 28-residue LRR 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HR6148
Sequence length 474
Comment $ NESG $ SQ188693 $ PDBT157445 $
Sequence
MSIQAPPRLLELAGQSLLRDQALSISAMEELPRVLYLPLFMEAFSRRHFQTLTVMVQAWP
FTCLPLGSLMKTLHLETLKALLEGLHMLLTQKDRPRRWKLQVLDLRDVDENFWARWPGAW
ALSCFPETTSKRQTAEDCPRMGEHQPLKVFIDICLKEIPQDECLRYLFQWVYQRRGLVHL
CCSKLVNYLTPIKYLRKSLKIIYLNSIQELEIRNMSWPRLIRKLRCYLKEMKNLRKLVFS
RCHHYTSDNELQGRLVAKFSSVFLRLEHLQLLKIKLITFFSGHLEQLIRCLQNPLENLEL
TYGYLLEEDMKCLSQYPSLGYLKHLNLSYVLLFRISLEPLGALLEKIAASLKTLILEGCQ
IHYSQLSAILPALSRCSQLTTFYFGRNCMSIDALKDLLRHTSGLSKLSLETYPAPEESLN
SLVRVNWEIFTPLRAELMCTLREVRQPKRIFIGPTPCPSCGSSPSEELELHLCC
Download sequence
Identical sequences HR6148 ENSP00000332134 gi|12738831|ref|NP_075389.1| ENSP00000332134 9606.ENSP00000332134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]