SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HR6409 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HR6409
Domain Number 1 Region: 108-182
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.14e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HR6409
Sequence length 202
Comment $ NESG $ SQ156995 $ PDBT169851 $
Sequence
MMQDVSSSPVSPADDSLSNSEEEPDRQQPPSGKRGGRKRRSSRRSAGGGAGPGGAAGGGV
GGGDEPGSPAQGKRGKKSAGCGGGGGAGGGGGSSSGGGSPQSYEELQTQRVMANVRERQR
TQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAH
ERLSYAFSVWRMEGAWSMSASH
Download sequence
Identical sequences Q15672
ENSP00000242261 gi|4507741|ref|NP_000465.1| 9606.ENSP00000242261 NP_000465.1.87134 NP_000465.1.92137 XP_011513798.1.92137 HR6409 NYSGXRC-13001a ENSP00000416986 ENSP00000242261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]