SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HR6664 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HR6664
Domain Number 1 Region: 14-269
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 2.23e-78
Family Glycerol kinase 0.000000991
Further Details:      
 
Domain Number 2 Region: 268-514
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 2.65e-74
Family Glycerol kinase 0.000000893
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HR6664
Sequence length 553
Comment $ NESG $ SQ252696 $ PDBT170551 $
Sequence
MAAPKTAAVGPLVGAVVQGTNSTRFLVFNSKTAELLSHHKVELTQEFPKEGWVEQDPKEI
LQSVYECIARTCEKLDELNIDISNIKAVGVSNQRETTVIWDKLTGEPLYNAVVWLDLRTQ
TTVEDLSKKIPGNSNFVKSKTGLPLSTYFSAVKLRWMLDNVRNVQKAVEEGRALFGTIDS
WLIWSLTGGVNGGVHCTDVTNASRTMLFNIHSLEWDKELCDFFEIPMDLLPNVFSSSEIY
GLIKTGALEGVPISGCLGDQCAALVGQMCFQEGQAKNTYGTGCFLLCNTGRKCVFSEHGL
LTTVAYKLGREKPAYYALEGSVAIAGAVIRWLRDNLGIIETSGDIERLAKEVGTSYGCYF
VPAFSGLYAPYWEPSARGILCGLTQFTNKCHIAFAALEAVCFQTREILEAMNRDCGIPLR
HLQVDGGMTNNKVLMQLQADILHIPVIKPFMPETTALGAAMAAGAAEGVSVWSLEPQALS
VLRMERFEPQIQATESEIRYATWKKAVMKSMGWVTSQSPEGGDPSIFSSLPLGFFIVSSM
VMLIGARYISGVP
Download sequence
Identical sequences A0A140VKG0 Q14410
ENSP00000351706 ENSP00000351706 gi|41393575|ref|NP_149991.2| HR6664 NP_149991.2.87134 NP_149991.2.92137 ENSP00000351706 9606.ENSP00000351706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]