SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HR992 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HR992
Domain Number 1 Region: 5-47
Classification Level Classification E-value
Superfamily UBA-like 0.00000000289
Family TAP-C domain-like 0.023
Further Details:      
 
Weak hits

Sequence:  HR992
Domain Number - Region: 52-171
Classification Level Classification E-value
Superfamily Tex N-terminal region-like 0.0157
Family Tex N-terminal region-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HR992
Sequence length 186
Comment $ NESG $ SQ31471 $ PDBT119322 $
Sequence
MHKLKSSQKDKVRQFMACTQAGERTAIYCLTQNEWRLDEATDSFFQNPDSLHRESMRNAV
DKKKLERLYGRYKDPQDENKIGVDGIQQFCDDLSLDPASISVLVIAWKFRAATQCEFSRK
EFLDGMTELGCDSMEKLKALLPRLEQELKDTAKFKDFYQFTFTFAKNPGQKGLGSPPFLN
VKALHH
Download sequence
Identical sequences HR992 ENSP00000364548 ENSP00000364552 ENSP00000364552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]