SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HT6303 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HT6303
Domain Number 1 Region: 135-185
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000895
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Domain Number 2 Region: 267-342
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000351
Family APG12-like 0.093
Further Details:      
 
Weak hits

Sequence:  HT6303
Domain Number - Region: 24-34
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0288
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HT6303
Sequence length 352
Comment $ NESG $ SQ217637 $ PDBT166357 $
Sequence
MEGVAVVTAGSVGAAKTEGAAALPPPPPPPVSPPALTPAPAAGEEGPAPLSETGAPGCSG
SRPPELEPERSLGRFRGRFEDEDEELEEEEELEEEEEEEEEDMSHFSLRLEGGRQDSEDE
EERLINLSELTPYILCSICKGYLIDATTITECLHTFCKSCIVRHFYYSNRCPKCNIVVHQ
TQPLYNIRLDRQLQDIVYKLVINLEEREKKQMHDFYKERGLEVPKPAVPQPVPSSKGRSK
KVLESVFRIPPELDMSLLLEFIGANEGTGHFKPLEKKFVRVSGEATIGHVEKFLRRKMGL
DPACQVDIICGDHLLEQYQTLREIRRAIGDAAMQDGLLVLHYGLVVSPLKIT
Download sequence
Identical sequences HT6303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]