SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for IGBMC-0122-000 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  IGBMC-0122-000
Domain Number 1 Region: 57-188,335-471
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.88e-53
Family Tandem AAA-ATPase domain 0.0000426
Further Details:      
 
Domain Number 2 Region: 573-693
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 6.7e-30
Family XPF/Rad1/Mus81 nuclease 0.000048
Further Details:      
 
Domain Number 3 Region: 706-774
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.0000000000000445
Family Hef domain-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) IGBMC-0122-000
Sequence length 778
Comment $ SPINE $ SQ80528 $ PDBT330429 $
Sequence
MFIEHPLIKPKTLEARLYQQIIAANALKKKTLCVLSTGLGKTAIAILVIAGILTKKDGKV
LILAPSRPLVEQHYNRLKQVLNIDEDKIIALTGKIQPKKRAELYKKGKIFIATPQVIEND
IIAGRINVDEFILLIADEAHHTTGDHAYAFVAKKFKDKCHILGLTASPGSDIDKVMEICE
NLGIEHVEVRTEDDEDVKPYIAKVKLIPIRIDLPNEFKRALKLINEALKERLKILKDAGV
INSIADVTKTELIELNNKLFSYDEEVKYELIKVCSEALKLMHAKELLESQGKSVFLNYIN
KLSMQRTKSAKSIVNDEKVREAVNLLMKSDVEHPKLGKVVDMVKNILEKNKDERIIIFAQ
YRDTVEKIVNLLTQNGIKAIRFIGQANKEGKGMSQKEQIEAIERFKKEGSVLVSTSVSEE
GIDIPSVNYIIFYEPVPSEIRFIQRRGRAMRGEGGKVYVLIAKGTADEAYYRSALYKERE
MKRLLKNMCYLLNKRLQKKFEEKSKEEIKEETEEIKEKEIESKTAVKEETKEEEEKTKKP
VTILDFIKQIEVKERSKSEEDKIKQEIKIPKKPIKIIVDVREKNMAKLLHNYANIELKTL
EVGDYVLSDRVVVERKTAEDFVNSIIDKRLFSQLKNLKKVEKPLLIVEGENFSRLHENAL
KGAILSIILDFGIPIIFTKNAEETADLLIKIAEKEQIKEKRTVMVRYGKTAMSLKEQQKF
IVESLPDVGGALAERLLKHFKTVENVFTAKEEELMKVEGVGKERAKKIREVLTAEYEG
Download sequence
Identical sequences Q58900
243232.MJ1505 WP_010871028.1.84152 IGBMC-0122-000 gi|15669699|ref|NP_248512.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]