SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Lmaj005392AAA from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Lmaj005392AAA
Domain Number 1 Region: 423-476
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.00000000000000794
Family Transcriptional factor domain 0.0022
Further Details:      
 
Domain Number 2 Region: 167-246
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.00000000157
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0049
Further Details:      
 
Domain Number 3 Region: 7-50
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.000000349
Family PWWP domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Lmaj005392AAA
Sequence length 477
Comment $ SGPP $ SQ66645 $ PDBT224746 $
Sequence
GPGSMATYVPGDRVWVYIEGDGWWPACVLSDEEMGTRTPGFDLAVQFYAGVEQPATLYEL
NSHADAANICFFETSSEKAVTGNPELEAAIRCACAHAEANPLKSASAIVGGARVAAGGSG
AAGSSGAAVVDRAASKRVRDMGDDDTGVYSSGAAASRSVSGYHHLRSDKLHELSSKISSA
VAAADLTAVRAALCQLDGVDVYLTELEDTKIGVAVGSVLSQPVLKPLWPLARAMISFWAR
HLPAETLAAIRSVQQRQLPVPATSAAAAAEPPSPLSKQQPAFPAVPSGSAFASSVSPSAA
TAAGGAGAGAAGGAGSGDVAPTQRKTFYDNVYQLLDSPLSTTRYDDTVIDEVARRLTAEI
TDRDERQMLLLRLREEELSFIRDHLLSGEWTPKKYLDQPSEVFTTKSEKARQEQRIQEKM
KAIEAADNAMLNITSLFKCGRCGKRHCTFYEQQTRSADEPTTKYITCLDCKNTWTQE
Download sequence
Identical sequences Lmaj005392AAA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]