SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Lmaj012647AAA from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Lmaj012647AAA
Domain Number 1 Region: 13-111
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.000000000000451
Family PWWP domain 0.011
Further Details:      
 
Domain Number 2 Region: 327-389
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.00000000000484
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0048
Further Details:      
 
Domain Number 3 Region: 557-598
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0000425
Family Transcriptional factor domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Lmaj012647AAA
Sequence length 601
Comment $ SGPP $ SQ69114 $ PDBT227180 $
Sequence
MAHHHHHHMSASTSADYPVNSWVWVRQSGYPWWPAMVLDPAQAGQDPPEGTDVVLLCGPS
ASATLVFASSADAEQLRPYHGAAEDAELIEAGRSDESCAAAIEEMLAAVASTDAAPSEEG
LHTTPSASGAAMGHGNHAFSGEDDVDWEALAAEAEAAMAEPQSAVAQEKHKKDKKHNKRK
SNGSSGGDGHADCDGSRKTRKDKSSKGHRRHRGGDADSANEAEVSSGGDNDDSKNDEDVF
QRRKGAFSSRSAMKKVKYERQSKLEEYDLGPGTLSDYSPRNDPAYYYRKVRSARRAASST
ELRTCTQELRGFMSRCLSGAATALDVEADILGVLRQLKNVDVTLAQLQETGVGVAIGSLL
RFFTPPVVQLAQAILNYWFHSLPQNTQQQLSAENEVDRCSIETCSDGVAGDNELGRIGVN
LFSCFTNEEINDAPASVDVMALCGSIEDALERRCDSDAQMLVLFAFGDTSDTGKALRRLL
LEGKIYVEDIINHTGNLPLLVRTRQRRPANMQFTFDSPAPQDRSDIDSPNSPYAAFSPND
DGSTGSPTFGSPTGRTTTALYSCPHCGANDAYQSSYSVQAHDNMPDILRCKKCGQTWNVA
E
Download sequence
Identical sequences Lmaj012647AAA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]