SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MmR256 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MmR256
Domain Number 1 Region: 6-128
Classification Level Classification E-value
Superfamily DNA clamp 2.44e-18
Family DNA polymerase processivity factor 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MmR256
Sequence length 389
Comment $ NESG $ SQ186485 $ PDBT155509 $
Sequence
MKCLITGGNVKVLGKAVHSLSRIGDELYLEPLKDGLSLRTVNSSRSAYACFLFAPLFFQQ
YQAASPGQDLLRCKILMKAFLSVFRSLAIVEKSVEKCCISLSGSHSHLVVQLHCKYGVKK
THNLSFQDCESLQAVFDPASCPHLLRTPARVLAEAVLSFPLALTEVTLGIGRGRRVILRS
YQEEEADSTSKAMVTETSIGDEDFQQLHAPEGIAVTFCLKEFRGLLSFAESANLPLTIHF
DVPGRPVIFTIEDSLLDAHFVLATLLEQDSCSQGPCSPKPHQPVPQKQAHSTPHLDDFTS
DDIDCYMIAMETTGGNEGSGAQPSTSLPPVSLASHDLAPTSEEEAEPSTVPGTPPPKKFR
SLFFGSILAPVHSPQGPNPVLAEDSDGEG
Download sequence
Identical sequences Q9Z0F6
MmR256 ENSMUSP00000025740 ENSMUSP00000137976 ENSMUSP00000025740 ENSMUSP00000025740 NP_035367.1.92730 10090.ENSMUSP00000025740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]