SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NYSGRC-10190680 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NYSGRC-10190680
Domain Number 1 Region: 92-163
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.32e-17
Family HLH, helix-loop-helix DNA-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NYSGRC-10190680
Sequence length 181
Comment $ NYSGXRC $ SQ244333 $ PDBT197594 $
Sequence
MMDNRGNSSLPDKLPIFPDSARLPLTRSFYLEPMVTFHVHPEAPVSSPYSEELPRLPFPS
DSLILGNYSEPCPFSFPMPYPNYRGCEYSYGPAFTRKRNERERQRVKCVNEGYAQLRHHL
PEEYLEKRLSKVETLRAAIKYINYLQSLLYPDKAETKNNPGKVSSMIATTSHHADPMFRI
V
Download sequence
Identical sequences 9606.ENSP00000318846 ENSP00000435770 NP_065697.1.87134 NP_065697.1.92137 gi|10190680|ref|NP_065697.1| ENSP00000318846 ENSP00000435770 ENSP00000318846 NYSGRC-10190680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]