SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NYSGRC-150378537 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NYSGRC-150378537
Domain Number 1 Region: 619-724
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.64e-16
Family Ankyrin repeat 0.0019
Further Details:      
 
Weak hits

Sequence:  NYSGRC-150378537
Domain Number - Region: 265-310,339-386
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0837
Family Cytochrome c3-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NYSGRC-150378537
Sequence length 752
Comment $ NYSGXRC $ SQ243673 $ PDBT196336 $
Sequence
MTAGSVCVPQIIPLRVPQPGKANHEIDNNTLLEMKSDTPDVNIYYTLDGSKPEFLKRIGY
GENNTFKYIKPITLPDGKIQVKAIAVSKDCRQSGIVTKVFHVDYEPPNIVSPEDNVENVL
KDSSRQEFKNGFVGSKLKKKYKNSENQRSWNVNLRKFPESPLEIPAYGGGSGSRPPTRQS
QSPGFAHVSGQKCLTSTEIMRIQRETDFLKCAHCLAPRPSDPFARFCQECGSPVPPIFGC
RLPPPEGAQMGLCAECRSLVPMNTPICVVCEAPLALQLQPQASLHLKEKVICRACGTGNP
AHLRYCVTCEGALPSSQESMCSGDKAPPPPTQKGGTISCYRCGRWNLWEASFCGWCGAML
GIPAGCSVCPKCGASNHLSARFCGSCGICVKSLVKLSLDRSLALAAEEPRPFSESLNIPL
PRSDVGTKRDIGTQTVGLFYPSGKLLAKKEQELASQKQRQEKMSDHKPLLTAISPGRGYW
RRQLDHISAHLRCYAQNNPEFRALIAEPRMGKLISATVHEDGCEVSIRLNYSQVSNKNLY
LNKAVNFSDHLLSSAAEGDGGLCGSRSSWVSDYSQSTSDTIEKIKRIKNFKTKTFQEKKE
QLIPENRLLLKEVGPTGEGRVSVIEQLLDEGADPNCCDEDNRPVITVAVMNKHHEAIPVL
VQRGADIDQQWGPLRNTALHEATLLGLAGRESTATLLGCNASIQKKNAGGQTAYDLALNT
GDDLVTSLFAAKFGQGLEDQLAQTRSLSLDDC
Download sequence
Identical sequences Q9NVP4
ENSP00000262547 ENSP00000351734 9606.ENSP00000262547 gi|150378537|ref|NP_001092877.1| NYSGRC-150378537 NP_001092877.1.87134 NP_001092877.1.92137 ENSP00000262547 ENSP00000351734 ENSP00000351734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]